Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit 9, mitochondrial (ATP9)

This Recombinant ATP synthase subunit 9, mitochondrial (ATP9) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

ATP synthase subunit 9, mitochondrial, Lipid-binding protein

UniProt

P16001

Expression Region

1-75

Origin

Paramecium tetraurelia

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLVLAIKTLVLGLCMLPISAAALGVGILFAGYNIAVSRNPDEAETIFNGTLMGFALVET FVFMSFFFGVIVYFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-4-Hydroxyphenyl-N'-1,2,3-thiadiazol-5-ylurea
TRC-H949385-2.5G 2.5 g

N-4-Hydroxyphenyl-N'-1,2,3-thiadiazol-5-ylurea

Sign In for Pricing
View Details
Anti-PGC1 beta/PPARGC1B Picoband® Antibody Fluoro550 Conjugated
A02933-1-Fluoro550 100 µg/Vial

Anti-PGC1 beta/PPARGC1B Picoband® Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
Bovine Fragile X mental retardation syndrome-related protein 1, FXR1 ELISA Kit
MBS9322104-01 48 Well

Bovine Fragile X mental retardation syndrome-related protein 1, FXR1 ELISA Kit

Sign In for Pricing
View Details
Bovine Fragile X mental retardation syndrome-related protein 1, FXR1 ELISA Kit
MBS9322104-02 96 Well

Bovine Fragile X mental retardation syndrome-related protein 1, FXR1 ELISA Kit

Sign In for Pricing
View Details
Bovine Fragile X mental retardation syndrome-related protein 1, FXR1 ELISA Kit
MBS9322104-03 5x 96 Well

Bovine Fragile X mental retardation syndrome-related protein 1, FXR1 ELISA Kit

Sign In for Pricing
View Details
Bovine Fragile X mental retardation syndrome-related protein 1, FXR1 ELISA Kit
MBS9322104-04 10x 96 Well

Bovine Fragile X mental retardation syndrome-related protein 1, FXR1 ELISA Kit

Sign In for Pricing
View Details