Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit 9, mitochondrial (ATP9)

This Recombinant ATP synthase subunit 9, mitochondrial (ATP9) spans the amino acid sequence from region 1-75.

Product Specifications

Product Name Alternative

ATP synthase subunit 9, mitochondrial, Lipid-binding protein

UniProt

P16001

Expression Region

1-75

Origin

Paramecium tetraurelia

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLVLAIKTLVLGLCMLPISAAALGVGILFAGYNIAVSRNPDEAETIFNGTLMGFALVET FVFMSFFFGVIVYFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRSF1 Recombinant Antibody, PE Conjugated
bsm-62226R-PE-TR 20 µL

GRSF1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
USF2 AAV Vector (Rat) (CMV)
49257106 1 µg

USF2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Uroguanylin (Highly Pure)
B2014258 0.1 mg

Uroguanylin (Highly Pure)

Sign In for Pricing
View Details
PMP2 Antibody (FITC)
orb242239-01 50 µg

PMP2 Antibody (FITC)

Sign In for Pricing
View Details
PMP2 Antibody (FITC)
orb242239-02 100 µg

PMP2 Antibody (FITC)

Sign In for Pricing
View Details
MSTO1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-06873 0.1 mg

MSTO1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details