Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SARS coronavirus Envelope small membrane protein (E)

This Recombinant Human SARS coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P59637

Expression Region

1-76

Origin

Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR5588 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV733324 1.0 µg DNA

MIR5588 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TREM2 Blocking Peptide
33R-3016 100 ug

TREM2 Blocking Peptide

Sign In for Pricing
View Details
Human FTL shRNA Plasmid
abx951661-01 150 µg

Human FTL shRNA Plasmid

Sign In for Pricing
View Details
Human FTL shRNA Plasmid
abx951661-02 300 µg

Human FTL shRNA Plasmid

Sign In for Pricing
View Details
SDHDP6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV748110 1.0 µg DNA

SDHDP6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
PTK7 Protein Vector (Human) (pPM-C-His)
PV114141 500 ng

PTK7 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details