Recombinant Human SARS coronavirus Envelope small membrane protein (E)
This Recombinant Human SARS coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.
Product Specifications
Product Name Alternative
Envelope small membrane protein, E protein, sM protein
UniProt
P59637
Expression Region
1-76
Origin
Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Field of Research
Infectious Disease & Virology; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6484454-01 0.1 mL
KLF5, CT (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2) (MaxLight
Sign In for Pricing
View Details 
MBS6484454-02 5x 0.1 mL
KLF5, CT (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2) (MaxLight
Sign In for Pricing
View Details 
