Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SARS coronavirus Envelope small membrane protein (E)

This Recombinant Human SARS coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P59637

Expression Region

1-76

Origin

Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Pax-8 antibody
STJ98311 100 µl

Anti-Pax-8 antibody

Sign In for Pricing
View Details
β-casein Lentiviral Activation Particles (h)
sc-402248-LAC 200 µL

β-casein Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Recombinant Streptococcus Gordonii wefC Protein (aa 1-333)
VAng-Cr7633-500gEcoli 500 µg (E. coli)

Recombinant Streptococcus Gordonii wefC Protein (aa 1-333)

Sign In for Pricing
View Details
Human Herpes simplexvirus II IgG antibody, HSVII-Ab ELISA Kit
MBS9424575-01 96 Tests

Human Herpes simplexvirus II IgG antibody, HSVII-Ab ELISA Kit

Sign In for Pricing
View Details
Human Herpes simplexvirus II IgG antibody, HSVII-Ab ELISA Kit
MBS9424575-02 5x 96 Tests

Human Herpes simplexvirus II IgG antibody, HSVII-Ab ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human eIF2B epsilon mAb
MA1297-01 50 μL

Rabbit Anti-Human eIF2B epsilon mAb

Sign In for Pricing
View Details