Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein sfa (sfa)

This Recombinant Protein sfa (sfa) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Protein sfa

UniProt

P0AAA6

Expression Region

1-76

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTL LACCCLLRPEEVNSEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PC4/SUB1 Antibody Picoband® (monoclonal, 2D13E3) Fluoro647 Conjugated
M02698-1-Fluoro647 100 µg/Vial

Anti-PC4/SUB1 Antibody Picoband® (monoclonal, 2D13E3) Fluoro647 Conjugated

Sign In for Pricing
View Details
NDST4, NT (NDST4, HSST4, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan sulfate sulfotransferase 4, Heparan sulfate N-deacetylase 4, Heparan sulfate N-sulfotransferase 4) (MaxLig
MBS6324328-01 0.1 mL

NDST4, NT (NDST4, HSST4, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan sulfate sulfotransferase 4, Heparan sulfate N-deacetylase 4, Heparan sulfate N-sulfotransferase 4) (MaxLig

Sign In for Pricing
View Details
NDST4, NT (NDST4, HSST4, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan sulfate sulfotransferase 4, Heparan sulfate N-deacetylase 4, Heparan sulfate N-sulfotransferase 4) (MaxLig
MBS6324328-02 5x 0.1 mL

NDST4, NT (NDST4, HSST4, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan sulfate sulfotransferase 4, Heparan sulfate N-deacetylase 4, Heparan sulfate N-sulfotransferase 4) (MaxLig

Sign In for Pricing
View Details
Rat Trefoil Factor 2 (TFF2) ELISA Kit
orb1948565-01 48 Tests

Rat Trefoil Factor 2 (TFF2) ELISA Kit

Sign In for Pricing
View Details
Rat Trefoil Factor 2 (TFF2) ELISA Kit
orb1948565-02 96 Tests

Rat Trefoil Factor 2 (TFF2) ELISA Kit

Sign In for Pricing
View Details
Congo Red Amyloid Stain Kit (Modified Stores Method)
G1532 4x 50 mL

Congo Red Amyloid Stain Kit (Modified Stores Method)

Sign In for Pricing
View Details