Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein sfa (sfa)

This Recombinant Protein sfa (sfa) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Protein sfa

UniProt

P0AAA6

Expression Region

1-76

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTL LACCCLLRPEEVNSEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tex55 Pre-designed siRNA Set A
SI114494A 1 Each

Mouse Tex55 Pre-designed siRNA Set A

Sign In for Pricing
View Details
NCEH1 Rabbit Polyclonal Antibody (FITC)
orb2112945 100 µL

NCEH1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human TRAPPC11 Protein Lysate
MBS8429050-01 0.02 mg

Human TRAPPC11 Protein Lysate

Sign In for Pricing
View Details
Human TRAPPC11 Protein Lysate
MBS8429050-02 5x 0.02 mg

Human TRAPPC11 Protein Lysate

Sign In for Pricing
View Details
PRR23A Rabbit Polyclonal Antibody (BF488)
orb2469649 100 µL

PRR23A Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
CDR2 siRNA (Mouse)
CRM0655-01 15 nmol

CDR2 siRNA (Mouse)

Sign In for Pricing
View Details