Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P0A305

Expression Region

1-76

Origin

Streptomyces lividans

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQTLAAVEGSLGSIGYGLAAIGPGVGVGIIFGNGTQAMARQPEAAGLIRANQILGFAFC EALALIGLVMPFVYGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FK506 Binding Protein 8 (FKBP8) ELISA Kit
MBS2162043-01 24 Strip Well

Human FK506 Binding Protein 8 (FKBP8) ELISA Kit

Sign In for Pricing
View Details
Human FK506 Binding Protein 8 (FKBP8) ELISA Kit
MBS2162043-02 48 Well

Human FK506 Binding Protein 8 (FKBP8) ELISA Kit

Sign In for Pricing
View Details
Human FK506 Binding Protein 8 (FKBP8) ELISA Kit
MBS2162043-03 96 Well

Human FK506 Binding Protein 8 (FKBP8) ELISA Kit

Sign In for Pricing
View Details
Human FK506 Binding Protein 8 (FKBP8) ELISA Kit
MBS2162043-04 5x 96 Well

Human FK506 Binding Protein 8 (FKBP8) ELISA Kit

Sign In for Pricing
View Details
Human FK506 Binding Protein 8 (FKBP8) ELISA Kit
MBS2162043-05 10x 96 Well

Human FK506 Binding Protein 8 (FKBP8) ELISA Kit

Sign In for Pricing
View Details
MEF2A Rabbit mAb
orb1564638-01 20 ul

MEF2A Rabbit mAb

Sign In for Pricing
View Details