Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P0A305

Expression Region

1-76

Origin

Streptomyces lividans

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQTLAAVEGSLGSIGYGLAAIGPGVGVGIIFGNGTQAMARQPEAAGLIRANQILGFAFC EALALIGLVMPFVYGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1)
252396 100 µg

TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1)

Sign In for Pricing
View Details
CD106 (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110)
MBS6507227-01 0.5 mg

CD106 (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110)

Sign In for Pricing
View Details
CD106 (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110)
MBS6507227-02 5x 0.5 mg

CD106 (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110)

Sign In for Pricing
View Details
Human Keratin 14 (KRT14) Antibody Pair Kit (with Standard)
MBS2099045-01 5x 96 Tests

Human Keratin 14 (KRT14) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Keratin 14 (KRT14) Antibody Pair Kit (with Standard)
MBS2099045-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Keratin 14 (KRT14) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Keratin 14 (KRT14) Antibody Pair Kit (with Standard)
MBS2099045-03 10x 96 Tests

Human Keratin 14 (KRT14) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details