Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein sfa (sfa)

This Recombinant Escherichia coli Protein sfa (sfa) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Protein sfa

UniProt

P0AAA5

Expression Region

1-76

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTL LACCCLLRPEEVNSEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFIC (NM_005597) Human Recombinant Protein
TP304184L 1 mg

NFIC (NM_005597) Human Recombinant Protein

Sign In for Pricing
View Details
CD10 (MME) (NM_007289) Human Over-expression Lysate
LY429338 100 µg

CD10 (MME) (NM_007289) Human Over-expression Lysate

Sign In for Pricing
View Details
Isopropyl 2-Isopropylphenyl Ether
TRC-I872100-250MG 250 mg

Isopropyl 2-Isopropylphenyl Ether

Sign In for Pricing
View Details
D-Lysine hydrochloride
TRC-L468918-2.5G 2.5 g

D-Lysine hydrochloride

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), 1mg/mL
BNUM3102-50 1x 50 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), 1mg/mL

Sign In for Pricing
View Details
Tropomyosin 2 (TPM2) (NM_213674) Human Over-expression Lysate
LY403737 100 µg

Tropomyosin 2 (TPM2) (NM_213674) Human Over-expression Lysate

Sign In for Pricing
View Details