Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein sfa (sfa)

This Recombinant Escherichia coli Protein sfa (sfa) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Protein sfa

UniProt

P0AAA5

Expression Region

1-76

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRWISQNNIRLPRGAFFISALFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTL LACCCLLRPEEVNSEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INO80C (NM_001098817) Human Over-expression Lysate
LY420349 100 µg

INO80C (NM_001098817) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Phenyl-1,2-benzoselenazol-3-one (Ebselen)
TRC-P319510-1G 1 g

2-Phenyl-1,2-benzoselenazol-3-one (Ebselen)

Sign In for Pricing
View Details
FKBP11 (C-term) Rabbit Polyclonal Antibody
AP18019PU-N 400 µL

FKBP11 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BORCS6 Antibody
KC-3299-01 50 μL

BORCS6 Antibody

Sign In for Pricing
View Details
BORCS6 Antibody
KC-3299-02 100 µL

BORCS6 Antibody

Sign In for Pricing
View Details
BORCS6 Antibody
KC-3299-03 1 mL

BORCS6 Antibody

Sign In for Pricing
View Details