Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. ATP synthase subunit c (atpE)

This Recombinant Dehalococcoides sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5FRR4

Expression Region

1-76

Origin

Dehalococcoides sp. (strain BAV1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKGSIFTNMILLVAFAES IAIFALVISIVLIFVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mapk1ip1 (NM_001122782) Rat Tagged ORF Clone Lentiviral Particle
RR214896L3V 200 µL

Mapk1ip1 (NM_001122782) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FCN3 (NM_003665) Human Tagged ORF Clone Lentiviral Particle
RC220435L2V 200 µL

FCN3 (NM_003665) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C1orf112 Antibody (FITC)
orb37576-01 50 µg

C1orf112 Antibody (FITC)

Sign In for Pricing
View Details
C1orf112 Antibody (FITC)
orb37576-02 100 µg

C1orf112 Antibody (FITC)

Sign In for Pricing
View Details
Monkey Pituitary specific positive transcription factor 1 (POU1F1) ELISA kit
GTR10374307 96 Well

Monkey Pituitary specific positive transcription factor 1 (POU1F1) ELISA kit

Sign In for Pricing
View Details
Hydroxy-PEG11-Boc
T18033-01 100 mg

Hydroxy-PEG11-Boc

Sign In for Pricing
View Details