Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. ATP synthase subunit c (atpE)

This Recombinant Dehalococcoides sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5FRR4

Expression Region

1-76

Origin

Dehalococcoides sp. (strain BAV1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKGSIFTNMILLVAFAES IAIFALVISIVLIFVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal DLL4 Antibody (447506) [HRP]
FAB1506H 0.1 mL

Rat Monoclonal DLL4 Antibody (447506) [HRP]

Sign In for Pricing
View Details
Goat Coiled coil domain containing protein 33 (CCDC33) ELISA Kit
GTR10334869 96 Well

Goat Coiled coil domain containing protein 33 (CCDC33) ELISA Kit

Sign In for Pricing
View Details
Anti-Certolizumab Neutralizing Recombinant Antibody (SAA2961)
AF879213-01 50 µg

Anti-Certolizumab Neutralizing Recombinant Antibody (SAA2961)

Sign In for Pricing
View Details
Anti-Certolizumab Neutralizing Recombinant Antibody (SAA2961)
AF879213-02 100 µg

Anti-Certolizumab Neutralizing Recombinant Antibody (SAA2961)

Sign In for Pricing
View Details
Human PUMA-alpha (p53-upregulated modulator of apoptosis) control peptide #1
PUMA12-P 100 µg

Human PUMA-alpha (p53-upregulated modulator of apoptosis) control peptide #1

Sign In for Pricing
View Details
Recombinant Human GRP78/HSPA5 Protein, N-His
orb3056485-01 50 µg

Recombinant Human GRP78/HSPA5 Protein, N-His

Sign In for Pricing
View Details