Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. ATP synthase subunit c (atpE)

This Recombinant Dehalococcoides sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5FRR4

Expression Region

1-76

Origin

Dehalococcoides sp. (strain BAV1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKGSIFTNMILLVAFAES IAIFALVISIVLIFVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-9 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-20773R-BF405 100 µL

Caspase-9 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
rHu CD40 Ligand
AK9162-0100 100µg

rHu CD40 Ligand

Sign In for Pricing
View Details
HA Protein (C-His, H3N2)
P520460 100 µg

HA Protein (C-His, H3N2)

Sign In for Pricing
View Details
DHODH Antibody - N-terminal region
ARP41876_P050-25UL 25 µL

DHODH Antibody - N-terminal region

Sign In for Pricing
View Details
2-Bromocyclohexane-1-carbonitrile
YEA80487-01 50 mg

2-Bromocyclohexane-1-carbonitrile

Sign In for Pricing
View Details
2-Bromocyclohexane-1-carbonitrile
YEA80487-02 0.5 g

2-Bromocyclohexane-1-carbonitrile

Sign In for Pricing
View Details