Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vanderwaltozyma polyspora ATP synthase subunit 9, mitochondrial (ATP9)

This Recombinant Vanderwaltozyma polyspora ATP synthase subunit 9, mitochondrial (ATP9) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit 9, mitochondrial, Lipid-binding protein

UniProt

A6H4Q2

Expression Region

1-76

Origin

Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSLRETLFPMAILGFALSEA TGLFCLMISFLLIYAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-100 1x 100 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-100 1x 100 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details