Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mitochondrial inner membrane organizing system protein 1 (Minos1)

This Recombinant Rat Mitochondrial inner membrane organizing system protein 1 (Minos1) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane organizing system protein 1

UniProt

B2RYW8

Expression Region

1-76

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSESEPGRKWDRCMADALVKLGTGFGLGMVFSLTFFKRRKWPLAFGSGVGLGMAYSNCQH DFQAPYLLHGKYVKEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pasteurella Multocida PM0491 Protein (aa 1-127)
VAng-Cr7081-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida PM0491 Protein (aa 1-127)

Sign In for Pricing
View Details
Wdr89 3'UTR Luciferase Stable Cell Line
TU223378 1.0 mL

Wdr89 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Cox7a2 (NM_022503) Rat Untagged Clone
RN213547 10 µg

Cox7a2 (NM_022503) Rat Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Ptpru shRNA (UAS) - Lentiviral mouse Ptpru shRNA (UAS) plasmid
GTR15202555 1 Vial

Lentiviral mouse Ptpru shRNA (UAS) - Lentiviral mouse Ptpru shRNA (UAS) plasmid

Sign In for Pricing
View Details
Fish Alkaline phosphatase, tissue-nonspecific isozyme, ALPL ELISA Kit
MBS9310845 Inquire

Fish Alkaline phosphatase, tissue-nonspecific isozyme, ALPL ELISA Kit

Sign In for Pricing
View Details
Oct-3/4 Double Nickase Plasmid (h2)
sc-410951-NIC-2 20 µg

Oct-3/4 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details