Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mitochondrial inner membrane organizing system protein 1 (Minos1)

This Recombinant Rat Mitochondrial inner membrane organizing system protein 1 (Minos1) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane organizing system protein 1

UniProt

B2RYW8

Expression Region

1-76

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSESEPGRKWDRCMADALVKLGTGFGLGMVFSLTFFKRRKWPLAFGSGVGLGMAYSNCQH DFQAPYLLHGKYVKEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ST8SIA3 Antibody
CTA3912-01 30 µL

Anti-ST8SIA3 Antibody

Sign In for Pricing
View Details
Anti-ST8SIA3 Antibody
CTA3912-02 50 μL

Anti-ST8SIA3 Antibody

Sign In for Pricing
View Details
Anti-ST8SIA3 Antibody
CTA3912-03 100 µL

Anti-ST8SIA3 Antibody

Sign In for Pricing
View Details
Anti-ST8SIA3 Antibody
CTA3912-04 200 µL

Anti-ST8SIA3 Antibody

Sign In for Pricing
View Details
Recombinant Nostoc ellipsosporum Cyanovirin-N
MBS1109107-01 0.02 mg (E-Coli)

Recombinant Nostoc ellipsosporum Cyanovirin-N

Sign In for Pricing
View Details
Recombinant Nostoc ellipsosporum Cyanovirin-N
MBS1109107-02 0.02 mg (Yeast)

Recombinant Nostoc ellipsosporum Cyanovirin-N

Sign In for Pricing
View Details