Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bifidobacterium longum subsp. infantis ATP synthase subunit c (atpE)

This Recombinant Bifidobacterium longum subsp. infantis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7GTY8

Expression Region

1-76

Origin

Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIITLAEVAGNLSVIGYGIGTLGPGIGLGILFGKAMESTARQPEMSGKIQTIMFIGLAL VEVLALIGFVAALIIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prolactin Antibody (Biotin)
KB-3684-01 50 μL

Prolactin Antibody (Biotin)

Sign In for Pricing
View Details
Prolactin Antibody (Biotin)
KB-3684-02 100 µL

Prolactin Antibody (Biotin)

Sign In for Pricing
View Details
Prolactin Antibody (Biotin)
KB-3684-03 1 mL

Prolactin Antibody (Biotin)

Sign In for Pricing
View Details
PAR4 (PAWR) (NM_002583) Human Over-expression Lysate
LY419234 100 µg

PAR4 (PAWR) (NM_002583) Human Over-expression Lysate

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3014), 1mg/mL
BNUM3014-50 1x 50 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3014), 1mg/mL

Sign In for Pricing
View Details
4-Fluorobenzal Chloride
TRC-F598163-500MG 500 mg

4-Fluorobenzal Chloride

Sign In for Pricing
View Details