Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroflexus aggregans ATP synthase subunit c (atpE)

This Recombinant Chloroflexus aggregans ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B8G6H1

Expression Region

1-76

Origin

Chloroflexus aggregans (strain MD-66 / DSM 9485)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGLNLVATALAVGLGAIGPGVGIGIIVSGAVQAIGRNPEIENRVVTYMFIGIAFTEALA IFGLVIAFLIGFGVLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), 0.2mg/mL
BNUB0253-100 1x 100 µL

Cytokeratin, LMW (AE-1), 0.2mg/mL

Sign In for Pricing
View Details
Nimotuzumab Biosimilar - Research Grade
ICH4008-1mg 1 mg

Nimotuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Integrated OR lamp BOPL-302
BOPL-302 1 Unit

Integrated OR lamp BOPL-302

Sign In for Pricing
View Details
3,5-Diisopropylphenol
TRC-D455295-250MG 250 mg

3,5-Diisopropylphenol

Sign In for Pricing
View Details
SIT1 Antibody
KC-2380-01 50 μL

SIT1 Antibody

Sign In for Pricing
View Details
SIT1 Antibody
KC-2380-02 100 µL

SIT1 Antibody

Sign In for Pricing
View Details