Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium cellulolyticum ATP synthase subunit c (atpE)

This Recombinant Clostridium cellulolyticum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B8I574

Expression Region

1-76

Origin

Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGTGIIAIAAAIAAFTGIGAGIGISLATGKAVEGIARQPEAAGSIRTSLLLGAALAEAT AIYGLVVALVLVFLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tube Roller BTUR-103
BTUR-103 1 Unit

Tube Roller BTUR-103

Sign In for Pricing
View Details
DYKDDDDK Tag (FLAG) Recombinant Mouse monoclonal Antibody
HA600138F 100 µL

DYKDDDDK Tag (FLAG) Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Human Protein Kinase B Beta (PKBb) ELISA Kit
RD-PKBb-Hu-01 96 Tests

Human Protein Kinase B Beta (PKBb) ELISA Kit

Sign In for Pricing
View Details
Human Protein Kinase B Beta (PKBb) ELISA Kit
RD-PKBb-Hu-02 48 Tests

Human Protein Kinase B Beta (PKBb) ELISA Kit

Sign In for Pricing
View Details
Human MRPS28 activation kit by CRISPRa
GA109168 1 Kit

Human MRPS28 activation kit by CRISPRa

Sign In for Pricing
View Details
Stag2 Antibody
KC-1844-01 50 μL

Stag2 Antibody

Sign In for Pricing
View Details