Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium cellulolyticum ATP synthase subunit c (atpE)

This Recombinant Clostridium cellulolyticum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B8I574

Expression Region

1-76

Origin

Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGTGIIAIAAAIAAFTGIGAGIGISLATGKAVEGIARQPEAAGSIRTSLLLGAALAEAT AIYGLVVALVLVFLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA-3 (Breast and Urothelial Marker) (GATA3/2441), CF640R conjugate, 0.1mg/mL
BNC402441-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2441), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2881), CF594 conjugate, 0.1mg/mL
BNC942881-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2881), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VDAC1 Human Gene Knockout Kit (CRISPR)
KN209949LP 1 Kit

VDAC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCH772984
TRC-S199940-5MG 5 mg

SCH772984

Sign In for Pricing
View Details
TAF3 Recombinant Rabbit Monoclonal Antibody [JE64-97]
HA721107 100 µL

TAF3 Recombinant Rabbit Monoclonal Antibody [JE64-97]

Sign In for Pricing
View Details
Detomidine Hydrochloride
TRC-D297975-10MG 10 mg

Detomidine Hydrochloride

Sign In for Pricing
View Details