Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium cellulolyticum ATP synthase subunit c (atpE)

This Recombinant Clostridium cellulolyticum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B8I574

Expression Region

1-76

Origin

Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGTGIIAIAAAIAAFTGIGAGIGISLATGKAVEGIARQPEAAGSIRTSLLLGAALAEAT AIYGLVVALVLVFLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DL-2-Amino-1-pentanol
TRC-A632970-1G 1 g

DL-2-Amino-1-pentanol

Sign In for Pricing
View Details
U1A Recombinant Rabbit Monoclonal Antibody [JB33-48]
ET7107-98 100 µL

U1A Recombinant Rabbit Monoclonal Antibody [JB33-48]

Sign In for Pricing
View Details
Casd1 Mouse Gene Knockout Kit (CRISPR)
KN502558 1 Kit

Casd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
8-Hydroxy Guanosine-13C,15N2
TRC-H942772-5MG 5 mg

8-Hydroxy Guanosine-13C,15N2

Sign In for Pricing
View Details
PAK5 (NM_177990) Human Recombinant Protein
TP723910 100 µg

PAK5 (NM_177990) Human Recombinant Protein

Sign In for Pricing
View Details
iFluor™ 488 Conjugated p75 NGF Receptor Recombinant Rabbit Monoclonal Antibody [SA39-02]
HA720190F 100 µL

iFluor™ 488 Conjugated p75 NGF Receptor Recombinant Rabbit Monoclonal Antibody [SA39-02]

Sign In for Pricing
View Details