Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yoyI (yoyI)

This Recombinant Uncharacterized membrane protein yoyI (yoyI) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yoyI

UniProt

C0H438

Expression Region

1-76

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKVAKISVSCIVLVLCIYSLFNQNELLLIVVQLFVAALLSLVGVEAILSKQKLSEYLLF GSAAFLLVVNGVKFII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casp8 Mouse Gene Knockout Kit (CRISPR)
KN502570 1 Kit

Casp8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ent-Mavacamten
TRC-M299820-100MG 100 mg

Ent-Mavacamten

Sign In for Pricing
View Details
Cytokeratin 4+5+6+8+10+13+18 Mouse Monoclonal Antibody [Clone ID: SPM583]
AM50198PU-S 100 µg

Cytokeratin 4+5+6+8+10+13+18 Mouse Monoclonal Antibody [Clone ID: SPM583]

Sign In for Pricing
View Details
SASH1 Human Gene Knockout Kit (CRISPR)
KN418866 1 Kit

SASH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZSCAN31 antibody
FNab09685 100 µg

ZSCAN31 antibody

Sign In for Pricing
View Details
Neurofilament (NEFM) Human Gene Knockout Kit (CRISPR)
KN424475 1 Kit

Neurofilament (NEFM) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details