Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yoyI (yoyI)

This Recombinant Uncharacterized membrane protein yoyI (yoyI) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yoyI

UniProt

C0H438

Expression Region

1-76

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKVAKISVSCIVLVLCIYSLFNQNELLLIVVQLFVAALLSLVGVEAILSKQKLSEYLLF GSAAFLLVVNGVKFII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metabotropic Glutamate Receptor 4 (GRM4) Rabbit Polyclonal Antibody
TA371812 100 µL

Metabotropic Glutamate Receptor 4 (GRM4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3,5,6-Tribromo-1,2-dihydroacenaphthylene
TRC-T771875-50MG 50 mg

3,5,6-Tribromo-1,2-dihydroacenaphthylene

Sign In for Pricing
View Details
Dipyrrolidinylthiuram Disulfide-D16
TRC-D263054-2.5MG 2.5 mg

Dipyrrolidinylthiuram Disulfide-D16

Sign In for Pricing
View Details
SLC22A1 Recombinant Rabbit Monoclonal Antibody [JE37-67]
HA722335 100 µL

SLC22A1 Recombinant Rabbit Monoclonal Antibody [JE37-67]

Sign In for Pricing
View Details
5-Nitro[1,1'-biphenyl]-2,2'-diamine
TRC-N494020-100MG 100 mg

5-Nitro[1,1'-biphenyl]-2,2'-diamine

Sign In for Pricing
View Details
Ubxn10 Mouse Gene Knockout Kit (CRISPR)
KN518629 1 Kit

Ubxn10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details