Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yoyI (yoyI)

This Recombinant Uncharacterized membrane protein yoyI (yoyI) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yoyI

UniProt

C0H438

Expression Region

1-76

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKVAKISVSCIVLVLCIYSLFNQNELLLIVVQLFVAALLSLVGVEAILSKQKLSEYLLF GSAAFLLVVNGVKFII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMD8 (NM_001174156) Human Over-expression Lysate
LC433038 20 µg

SAMD8 (NM_001174156) Human Over-expression Lysate

Sign In for Pricing
View Details
Hamartin Recombinant Rabbit monoclonal Antibody
HA751528 100 µL

Hamartin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Sarnp Mouse Gene Knockout Kit (CRISPR)
KN515300 1 Kit

Sarnp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FIP200 (RB1CC1) (Center) Rabbit Polyclonal Antibody
AP53598PU-N 400 µL

FIP200 (RB1CC1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene Low Loaded Sieber Resin
HLL10024.25G 25 g

Polystyrene Low Loaded Sieber Resin

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF647 conjugate, 0.1mg/mL
BNC470979-100 1x 100 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details