Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Probable protein-export membrane protein SecG (secG)

This Recombinant Bacillus subtilis Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

O32233

Expression Region

1-76

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHAVLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRITVV LAVLFFVLTIALAYIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DENR qPCR Primer Pair
QH26613S 200 Tests

Human DENR qPCR Primer Pair

Sign In for Pricing
View Details
Actin, aortic smooth muscle Rabbit Polyclonal Antibody
E53P01993 100 µL

Actin, aortic smooth muscle Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TBXT/T/Brachyury Antibody
orb1537399 0.05 mL

TBXT/T/Brachyury Antibody

Sign In for Pricing
View Details
RGD1359378 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV660043 1.0 µg DNA

RGD1359378 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Monoclonal MS4A12 Antibody (OTI5F5) [DyLight 405]
NBP2-72791V 0.1 mL

Mouse Monoclonal MS4A12 Antibody (OTI5F5) [DyLight 405]

Sign In for Pricing
View Details
Human Transducin beta-like protein 3, TBL3 ELISA KIT
ELI-53149h 96 Tests

Human Transducin beta-like protein 3, TBL3 ELISA KIT

Sign In for Pricing
View Details