Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Probable protein-export membrane protein SecG (secG)

This Recombinant Bacillus subtilis Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

O32233

Expression Region

1-76

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHAVLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRITVV LAVLFFVLTIALAYIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNDC11 Antibody, FITC conjugated
A70024-50UG 50 µg

FNDC11 Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC2A12 Adenovirus (Human)
44093052 1.0 mL

SLC2A12 Adenovirus (Human)

Sign In for Pricing
View Details
Nori® Canine Fertulin A ELISA Kit
GR115287 96 Well

Nori® Canine Fertulin A ELISA Kit

Sign In for Pricing
View Details
ARF3 Antibody
orb309726 100 µL

ARF3 Antibody

Sign In for Pricing
View Details
GPx-6 Double Nickase Plasmid (h2)
sc-406587-NIC-2 20 µg

GPx-6 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Lentiviral mouse Lix1l shRNA (UAS) - Lentiviral mouseLix1l shRNA (UAS, GFP) (25)
GTR15301163 1 Vial

Lentiviral mouse Lix1l shRNA (UAS) - Lentiviral mouseLix1l shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details