Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Probable protein-export membrane protein SecG (secG)

This Recombinant Bacillus subtilis Probable protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein SecG

UniProt

O32233

Expression Region

1-76

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHAVLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRITVV LAVLFFVLTIALAYIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr832 Protein Vector (Mouse) (pPM-C-HA)
33482024 500 ng

Olfr832 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PCT Rabbit Monoclonal Antibody (Detector)
E56PA1101 100 µL

PCT Rabbit Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
ACADM Rabbit mAb Antibody
orb3014561 100 µL

ACADM Rabbit mAb Antibody

Sign In for Pricing
View Details
4-Bromo-2-iodopyridine
JH8061 1 Each

4-Bromo-2-iodopyridine

Sign In for Pricing
View Details
FAM175A ORF Vector (Human) (pORF)
ORF003819 1.0 µg DNA

FAM175A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Acrylamide-PEG-NHS
abx085142-01 2 KDa - 1 g

Acrylamide-PEG-NHS

Sign In for Pricing
View Details