Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yrhC (yrhC)

This Recombinant Bacillus subtilis Uncharacterized protein yrhC (yrhC) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Uncharacterized protein yrhC

UniProt

O05395

Expression Region

1-76

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKNRMKSLKEDYKHFAFTLLAVSTFLYIGAVLPDQGLTLGQKSTMFLADCVFLAGAFFC ADRSLIYKKRLEEADE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (2-Pyridyl) ethylthiourea
sc-265184 250 mg

2- (2-Pyridyl) ethylthiourea

Sign In for Pricing
View Details
SOCS3 (Suppressor of Cytokine Signaling 3, ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3) (MaxLight 405) discontinued
251957-ML405 100 µL

SOCS3 (Suppressor of Cytokine Signaling 3, ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
KCNRG Human siRNA Oligo Duplex (Locus ID 283518)
SR317034 1 Kit

KCNRG Human siRNA Oligo Duplex (Locus ID 283518)

Sign In for Pricing
View Details
Easypro Mouse Fetua (Fetuin A) ELISA Kit
FY-EM1211S 96 Well

Easypro Mouse Fetua (Fetuin A) ELISA Kit

Sign In for Pricing
View Details
CCDC97 (NM_052848) Human Over-expression Lysate
E45H13253-2 20 µg

CCDC97 (NM_052848) Human Over-expression Lysate

Sign In for Pricing
View Details
4- (4-Bromophenyl) -2-indol-3-yl-4-oxobutanoic acid
FB169485 5000 mg

4- (4-Bromophenyl) -2-indol-3-yl-4-oxobutanoic acid

Sign In for Pricing
View Details