Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yrhC (yrhC)

This Recombinant Bacillus subtilis Uncharacterized protein yrhC (yrhC) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Uncharacterized protein yrhC

UniProt

O05395

Expression Region

1-76

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKNRMKSLKEDYKHFAFTLLAVSTFLYIGAVLPDQGLTLGQKSTMFLADCVFLAGAFFC ADRSLIYKKRLEEADE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mycoplasma Antibody [6507]
orb1273078 0.1 mg

Mycoplasma Antibody [6507]

Sign In for Pricing
View Details
Phospho-c-Jun (Thr91) Rabbit Polyclonal Antibody (APC-Cy7)
orb1589152 100 µL

Phospho-c-Jun (Thr91) Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Interleukin 18 Binding Protein (IL18BP) BioAssayTM ELISA Kit (Human)
026155 96 Tests

Interleukin 18 Binding Protein (IL18BP) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
hsa-miR-4296 Primers
MPH01661 150 µL - 10 µM

hsa-miR-4296 Primers

Sign In for Pricing
View Details
PELI3 Peptide
orb2013319 100 µg

PELI3 Peptide

Sign In for Pricing
View Details
E330009J07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3633808 1.0 µg DNA

E330009J07Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details