Recombinant Bat coronavirus 279/2005 Envelope small membrane protein (E)
This Recombinant Bat coronavirus 279/2005 Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.
Product Specifications
Product Name Alternative
Envelope small membrane protein, E protein, sM protein
UniProt
Q0Q473
Expression Region
1-76
Origin
Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)
Field of Research
Metabolism Research; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MYSFVSEETGTLIVNSVLLFFAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402922-500 1x 500 µL
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2922), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC043069-500 1x 500 µL
Myofibroblast Marker (PR 2D3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RAF-411-1 1 mL
TRITC Conjugated Goat Affinity Purified Antibody to Bovine IgG Antibody
Sign In for Pricing
View Details