Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus 279/2005 Envelope small membrane protein (E)

This Recombinant Bat coronavirus 279/2005 Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q0Q473

Expression Region

1-76

Origin

Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSFVSEETGTLIVNSVLLFFAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032UC-01 25 µg

FITC Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
FITC Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032UC-02 100 µg

FITC Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
Vitamin D Binding protein (GC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A1]
TA809264BM 100 µL

Vitamin D Binding protein (GC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A1]

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF647 conjugate, 0.1mg/mL
BNC472741-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Keratin 16 Antibody
8C0241-AAT 50 µg

Keratin 16 Antibody

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF594 conjugate, 0.1mg/mL
BNC940693-500 1x 500 µL

CD56 / NCAM (123C3.D5 + 123A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details