Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus 279/2005 Envelope small membrane protein (E)

This Recombinant Bat coronavirus 279/2005 Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q0Q473

Expression Region

1-76

Origin

Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSFVSEETGTLIVNSVLLFFAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human B7-H6 Recombinant Rabbit monoclonal Antibody
HA723191 100 µL

Human B7-H6 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
AGFG1 (NM_001135189) Human Over-expression Lysate
LY427583 100 µg

AGFG1 (NM_001135189) Human Over-expression Lysate

Sign In for Pricing
View Details
GW9508
TRC-G931250-5MG 5 mg

GW9508

Sign In for Pricing
View Details
Ang3 Mouse Gene Knockout Kit (CRISPR)
KN501230 1 Kit

Ang3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HAUS1 (NM_138443) Human Recombinant Protein
TP304226 20 µg

HAUS1 (NM_138443) Human Recombinant Protein

Sign In for Pricing
View Details
Variable Volume Single Channel Micropipette BPIP-527
BPIP-527 1 Unit

Variable Volume Single Channel Micropipette BPIP-527

Sign In for Pricing
View Details