Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C27E2.12 (SPAC27E2.12)

This Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C27E2.12 (SPAC27E2.12) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C27E2.12

UniProt

Q2EEM0

Expression Region

1-76

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIQGLYQKRFCLFVCLERFQWRGAIFLVCYPLYCVVCFVSVLCRLYCILMSAASATQTI CDQSILHVHGVENMKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican-3 (GPC3/863), Biotin conjugate, 0.1mg/mL
BNCB0863-500 1x 500 µL

Glypican-3 (GPC3/863), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Keto 13-cis-Retinoic Acid-d3
TRC-K204972-5MG 5 mg

4-Keto 13-cis-Retinoic Acid-d3

Sign In for Pricing
View Details
SMC1 (SMC1A) Mouse Monoclonal Antibody [Clone ID: OTI5C8]
CF809808 100 µg

SMC1 (SMC1A) Mouse Monoclonal Antibody [Clone ID: OTI5C8]

Sign In for Pricing
View Details
Maltooctaose
TRC-M160150-250MG 250 mg

Maltooctaose

Sign In for Pricing
View Details
Human Nup53 (NUP35) activation kit by CRISPRa
GA115080 1 Kit

Human Nup53 (NUP35) activation kit by CRISPRa

Sign In for Pricing
View Details
Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit
E-EL-R3047-01 24 Tests

Rat βTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) ELISA Kit

Sign In for Pricing
View Details