Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C27E2.12 (SPAC27E2.12)

This Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C27E2.12 (SPAC27E2.12) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C27E2.12

UniProt

Q2EEM0

Expression Region

1-76

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIQGLYQKRFCLFVCLERFQWRGAIFLVCYPLYCVVCFVSVLCRLYCILMSAASATQTI CDQSILHVHGVENMKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymidylate Synthase (TS106 + TMS715), CF740 conjugate, 0.1mg/mL
BNC740716-100 1x 100 µL

Thymidylate Synthase (TS106 + TMS715), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HRP-AVI-Tag Monoclonal Antibody
E-AB-48001-01 25 µL

HRP-AVI-Tag Monoclonal Antibody

Sign In for Pricing
View Details
HRP-AVI-Tag Monoclonal Antibody
E-AB-48001-02 100 µL

HRP-AVI-Tag Monoclonal Antibody

Sign In for Pricing
View Details
Olefin impurity
TRC-O524490-25MG 25 mg

Olefin impurity

Sign In for Pricing
View Details
Sf1 Mouse Gene Knockout Kit (CRISPR)
KN515639 1 Kit

Sf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), 0.2mg/mL
BNUB1917-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), 0.2mg/mL

Sign In for Pricing
View Details