Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C27E2.12 (SPAC27E2.12)

This Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C27E2.12 (SPAC27E2.12) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C27E2.12

UniProt

Q2EEM0

Expression Region

1-76

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIQGLYQKRFCLFVCLERFQWRGAIFLVCYPLYCVVCFVSVLCRLYCILMSAASATQTI CDQSILHVHGVENMKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HRAS like suppressor (HRASLS) activation kit by CRISPRa
GA111378 1 Kit

Human HRAS like suppressor (HRASLS) activation kit by CRISPRa

Sign In for Pricing
View Details
Dansyl Chloride-d6
TRC-D177502-250MG 250 mg

Dansyl Chloride-d6

Sign In for Pricing
View Details
LOC653631 Human Gene Knockout Kit (CRISPR)
KN402219 1 Kit

LOC653631 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CALB1 Antibody
KC-3455-01 50 μL

CALB1 Antibody

Sign In for Pricing
View Details
CALB1 Antibody
KC-3455-02 100 µL

CALB1 Antibody

Sign In for Pricing
View Details
CALB1 Antibody
KC-3455-03 1 mL

CALB1 Antibody

Sign In for Pricing
View Details