Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yarrowia lipolytica ATP synthase subunit 9, mitochondrial (ATP9)

This Recombinant Yarrowia lipolytica ATP synthase subunit 9, mitochondrial (ATP9) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit 9, mitochondrial, Lipid-binding protein

UniProt

Q37695

Expression Region

1-76

Origin

Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLVLAGKYIGAGLASIGLVGAGIGIAIVFAALINGVSRNPALKGQLFTYSILGFALSEA TGLFALMIAFLLLYAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-100 1x 100 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
BNC680391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-100 1x 100 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF488A conjugate, 0.1mg/mL
BNC881683-500 1x 500 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details