Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus Rp3/2004 Envelope small membrane protein (E)

This Recombinant Bat coronavirus Rp3/2004 Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q3I5J3

Expression Region

1-76

Origin

Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS4 (NM_033028) Human Recombinant Protein
TP306210 20 µg

BBS4 (NM_033028) Human Recombinant Protein

Sign In for Pricing
View Details
rac N-Propyl-2-cyanimidopyrrolidine-5-acetic Acid
TRC-P835150-5MG 5 mg

rac N-Propyl-2-cyanimidopyrrolidine-5-acetic Acid

Sign In for Pricing
View Details
Cytokeratin-14 Antibody
KC-269-01 50 μL

Cytokeratin-14 Antibody

Sign In for Pricing
View Details
Cytokeratin-14 Antibody
KC-269-02 100 µL

Cytokeratin-14 Antibody

Sign In for Pricing
View Details
Cytokeratin-14 Antibody
KC-269-03 1 mL

Cytokeratin-14 Antibody

Sign In for Pricing
View Details
alpha Tubulin (TUBA4A) Mouse Monoclonal Antibody [Clone ID: 4C7-3B1-10G4]
TA385484 100 µL

alpha Tubulin (TUBA4A) Mouse Monoclonal Antibody [Clone ID: 4C7-3B1-10G4]

Sign In for Pricing
View Details