Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus Rp3/2004 Envelope small membrane protein (E)

This Recombinant Bat coronavirus Rp3/2004 Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q3I5J3

Expression Region

1-76

Origin

Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS700001 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
St3gal6 Mouse Gene Knockout Kit (CRISPR)
KN516801 1 Kit

St3gal6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zotepine N-Oxide
TRC-Z700905-50MG 50 mg

Zotepine N-Oxide

Sign In for Pricing
View Details
HOXC9 Polyclonal Antibody
E-AB-65942-01 60 µL

HOXC9 Polyclonal Antibody

Sign In for Pricing
View Details
HOXC9 Polyclonal Antibody
E-AB-65942-02 120 µL

HOXC9 Polyclonal Antibody

Sign In for Pricing
View Details
HOXC9 Polyclonal Antibody
E-AB-65942-03 200 µL

HOXC9 Polyclonal Antibody

Sign In for Pricing
View Details