Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU3 Envelope small membrane protein (E)

This Recombinant Bat coronavirus HKU3 Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q3LZW9

Expression Region

1-76

Origin

Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDM5 (100-200) Rabbit Polyclonal Antibody
AP08400PU-N 50 µg

PRDM5 (100-200) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human FGFR1OP2 protein (His tag)
PDEH101056-01 20 µg

Recombinant Human FGFR1OP2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FGFR1OP2 protein (His tag)
PDEH101056-02 100 µg

Recombinant Human FGFR1OP2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FGFR1OP2 protein (His tag)
PDEH101056-03 500 µg

Recombinant Human FGFR1OP2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FGFR1OP2 protein (His tag)
PDEH101056-04 1 mg

Recombinant Human FGFR1OP2 protein (His tag)

Sign In for Pricing
View Details
EIF4E Mouse Monoclonal Antibody [Clone ID: 5D11]
AM06602SU-N 100 µL

EIF4E Mouse Monoclonal Antibody [Clone ID: 5D11]

Sign In for Pricing
View Details