Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. ATP synthase subunit c (atpE)

This Recombinant Dehalococcoides sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3ZZU2

Expression Region

1-76

Origin

Dehalococcoides sp. (strain CBDB1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKGSIFTNMILLVAFAES IAIFALVISIVLIFVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin beta-C Antibody
MBS9418753-01 0.05 mL

Inhibin beta-C Antibody

Sign In for Pricing
View Details
Inhibin beta-C Antibody
MBS9418753-02 0.1 mL

Inhibin beta-C Antibody

Sign In for Pricing
View Details
Inhibin beta-C Antibody
MBS9418753-03 5x 0.1 mL

Inhibin beta-C Antibody

Sign In for Pricing
View Details
Catsper4 ORF Vector (Mouse) (pORF)
15092014 1.0 µg DNA

Catsper4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ZFP62 Rabbit pAb, PE-Cy7 conjugated
orb2870915 100 µL

ZFP62 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
eltB Antibody, Biotin conjugated
A50262-100UG 100 µg

eltB Antibody, Biotin conjugated

Sign In for Pricing
View Details