Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. ATP synthase subunit c (atpE)

This Recombinant Dehalococcoides sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3ZZU2

Expression Region

1-76

Origin

Dehalococcoides sp. (strain CBDB1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKGSIFTNMILLVAFAES IAIFALVISIVLIFVA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Aifm3 (NM_175178) AAV Particle
MR209288A1V 250 µL

Mouse Aifm3 (NM_175178) AAV Particle

Sign In for Pricing
View Details
Enkephalin [Met] amide
E3220-20E 1 mg

Enkephalin [Met] amide

Sign In for Pricing
View Details
Olfr564 (NM_146359) Mouse Tagged ORF Clone Lentiviral Particle
MR212645L4V 200 µL

Olfr564 (NM_146359) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
8- (Trifluoromethyl) quinolin-2-amine
PC1007300-01 50 mg

8- (Trifluoromethyl) quinolin-2-amine

Sign In for Pricing
View Details
8- (Trifluoromethyl) quinolin-2-amine
PC1007300-02 100 mg

8- (Trifluoromethyl) quinolin-2-amine

Sign In for Pricing
View Details
8- (Trifluoromethyl) quinolin-2-amine
PC1007300-03 250 mg

8- (Trifluoromethyl) quinolin-2-amine

Sign In for Pricing
View Details