Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0286421 (DDB_G0286421)

This Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0286421 (DDB_G0286421) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Uncharacterized transmembrane protein DDB_G0286421

UniProt

Q54LT5

Expression Region

1-76

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGINKPEPFGTGINVPYKLQKVQYFRENFQAFFKFTPKIVLNLVVLVGVVPLTWMFLGQ VQQDQKVIVNRKAREQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-100 1x 100 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (31A3), CF488A conjugate, 0.1mg/mL
BNC880046-100 1x 100 µL

Pgp9.5 (UCHL-1) (31A3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), Biotin conjugate, 0.1mg/mL
BNCB0040-500 1x 500 µL

CD35 / CR1 (E11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF488A conjugate, 0.1mg/mL
BNC881388-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF568 conjugate, 0.1mg/mL
BNC681563-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details