Recombinant Candida glabrata ATP synthase subunit 9, mitochondrial (ATP9)
This Recombinant Candida glabrata ATP synthase subunit 9, mitochondrial (ATP9) spans the amino acid sequence from region 1-76.
Product Specifications
Product Name Alternative
ATP synthase subunit 9, mitochondrial, Lipid-binding protein
UniProt
Q85Q98
Expression Region
1-76
Origin
Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MQLALAAKYIGAGISTIGLIGAGIGIGIVFAALINGVSRNPSLKDTLFSYSILGMALSEA TGLFCLMISFMLLFAV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400096-500 1x 500 µL
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 