Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein sfa (sfa)

This Recombinant Protein sfa (sfa) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Protein sfa

UniProt

Q8XC17

Expression Region

1-76

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHRWISQNNIRLPCGAFFISVLFFFNAVCIVSDNLLIIESFGEMAYNISYLTRVPGTNTL LACCCLLRPEEVNSEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PALMD Antibody
NBP1-88481 0.1 mL

Rabbit Polyclonal PALMD Antibody

Sign In for Pricing
View Details
SLC22A11 Rabbit Polyclonal Antibody (PE-Cy7)
orb967692 100 µL

SLC22A11 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Mouse Leng8 activation kit by CRISPRa
GA214380 1 Kit

Mouse Leng8 activation kit by CRISPRa

Sign In for Pricing
View Details
EGFR Antibody
AF0436-01 100 µL

EGFR Antibody

Sign In for Pricing
View Details
EGFR Antibody
AF0436-02 200 µL

EGFR Antibody

Sign In for Pricing
View Details
Magnetic Compass
1070480/4 1 Each

Magnetic Compass

Sign In for Pricing
View Details