Recombinant Candida albicans ATP synthase subunit 9, mitochondrial (ATP9)
This Recombinant Candida albicans ATP synthase subunit 9, mitochondrial (ATP9) spans the amino acid sequence from region 1-76.
Product Specifications
Product Name Alternative
ATP synthase subunit 9, mitochondrial, Lipid-binding protein
UniProt
Q9B8D5
Expression Region
1-76
Origin
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MQLALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALSEA CGLFCLMISFLLLYAV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680287-100 1x 100 µL
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 