Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Borrelia burgdorferi Uncharacterized protein BBD24 (BB_D24)

This Recombinant Borrelia burgdorferi Uncharacterized protein BBD24 (BB_D24) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Uncharacterized protein BBD24

UniProt

P70845

Expression Region

1-76

Origin

Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAIIVYSCLTMCVIYFHLQLKTFFTKLIRFCKKCFDIFLLLIEMLKLIFYLLIINNKFY IFIIISIALITINTMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Musashi 1 Recombinant Rabbit Monoclonal Antibody [SJ201]
ET1606-51 100 µL

Musashi 1 Recombinant Rabbit Monoclonal Antibody [SJ201]

Sign In for Pricing
View Details
Saysd1 Mouse Gene Knockout Kit (CRISPR)
KN515314 1 Kit

Saysd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), CF488A conjugate, 0.1mg/mL
BNC882448-100 1x 100 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethyl-d5 Paraben
TRC-E925477-10MG 10 mg

Ethyl-d5 Paraben

Sign In for Pricing
View Details
PCTAIRE3 (CDK18) (N-term) Rabbit Polyclonal Antibody
AP14187PU-N 400 µL

PCTAIRE3 (CDK18) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2790), 0.2mg/mL
BNUB2790-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2790), 0.2mg/mL

Sign In for Pricing
View Details