Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Borrelia burgdorferi Uncharacterized protein BBD24 (BB_D24)

This Recombinant Borrelia burgdorferi Uncharacterized protein BBD24 (BB_D24) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Uncharacterized protein BBD24

UniProt

P70845

Expression Region

1-76

Origin

Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAIIVYSCLTMCVIYFHLQLKTFFTKLIRFCKKCFDIFLLLIEMLKLIFYLLIINNKFY IFIIISIALITINTMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Oxo-L-pipecolic Acid
TRC-O858815-500MG 500 mg

6-Oxo-L-pipecolic Acid

Sign In for Pricing
View Details
Chromium Picolinate
TRC-C432745-5G 5 g

Chromium Picolinate

Sign In for Pricing
View Details
MIIP (NM_021933) Human Over-expression Lysate
LC402887 20 µg

MIIP (NM_021933) Human Over-expression Lysate

Sign In for Pricing
View Details
Tirap Mouse Gene Knockout Kit (CRISPR)
KN517596 1 Kit

Tirap Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Diallyl Phthalate
TRC-D416055-1G 1 g

Diallyl Phthalate

Sign In for Pricing
View Details
YES1 Human Gene Knockout Kit (CRISPR)
KN208432RB 1 Kit

YES1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details