Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Borrelia burgdorferi Uncharacterized protein BBD24 (BB_D24)

This Recombinant Borrelia burgdorferi Uncharacterized protein BBD24 (BB_D24) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Uncharacterized protein BBD24

UniProt

P70845

Expression Region

1-76

Origin

Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAIIVYSCLTMCVIYFHLQLKTFFTKLIRFCKKCFDIFLLLIEMLKLIFYLLIINNKFY IFIIISIALITINTMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Serpinb12 activation kit by CRISPRa
GA208986 1 Kit

Mouse Serpinb12 activation kit by CRISPRa

Sign In for Pricing
View Details
CF®488A Rabbit Anti-DNP, 2 mg/mL
#20866-250uL 1x 250 µL

CF®488A Rabbit Anti-DNP, 2 mg/mL

Sign In for Pricing
View Details
Cyclin E1 (Ab-77) Antibody
8B0636-AAT 50 µg

Cyclin E1 (Ab-77) Antibody

Sign In for Pricing
View Details
P21 / WAF1 (DCS-60.2), CF405S conjugate, 0.1mg/mL
BNC040822-100 1x 100 µL

P21 / WAF1 (DCS-60.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon: rectosigmoid
CP522801 150 µg

Tissue Protein Lysate, Colon: rectosigmoid

Sign In for Pricing
View Details
Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]
TA800089AM 100 µL

Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details