Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Protein CsbA (csbA)

This Recombinant Bacillus subtilis Protein CsbA (csbA) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Protein CsbA

UniProt

P37953

Expression Region

1-76

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITKAVFALFFPFMLVVLFTRVTFNHYVAIALTAALLFASYLKGYTETYFIVGLDVVSLV AGGLYMAKKAAEKKEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cosibelimab (Anti-B7-H1 / PD-L1 / CD274)
A2811-1mg*25 25x 1 mg

Cosibelimab (Anti-B7-H1 / PD-L1 / CD274)

Sign In for Pricing
View Details
Per3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3930605 3x 1.0 µg

Per3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human PRSS33 (Protease, Serine 33) ELISA Kit
MBS8805605-01 48 Well

Human PRSS33 (Protease, Serine 33) ELISA Kit

Sign In for Pricing
View Details
Human PRSS33 (Protease, Serine 33) ELISA Kit
MBS8805605-02 96 Well

Human PRSS33 (Protease, Serine 33) ELISA Kit

Sign In for Pricing
View Details
Human PRSS33 (Protease, Serine 33) ELISA Kit
MBS8805605-03 5x 96 Well

Human PRSS33 (Protease, Serine 33) ELISA Kit

Sign In for Pricing
View Details
Human PRSS33 (Protease, Serine 33) ELISA Kit
MBS8805605-04 10x 96 Well

Human PRSS33 (Protease, Serine 33) ELISA Kit

Sign In for Pricing
View Details